CABS-dock: C-H-287

Project name: C-H-287_3

Status: done

submitted: 2025-02-04 08:29:09, status changed: 2025-02-04 22:07:22

Project settings

Protein sequence(s)

MNMNVLVLCFVLSVSAEGLHVDRQVTGCSDHDGEEVYNLDGEEMWFADFIKREGVEPQPPFIDHITYQDGTYQTAEANQQTCKSNLDVVRTAMKDFKIEDEPPSSPMIYTRDAVELGGENTLICHVTGFYPAPVHVYWTKNGVDVTEGTSLNVPYPNTDGSFRQTARLKFIAQQGDVYSCTVSHLALDQSLTKIWDVDVQQPSVGPAVFCGVGLSVGLLGVAAGTFFLIKGNECSMASFILSFSLFFITVCTANGFRYYVVNSCEFNSSKLNDIEFTESYYYNKLEYIRFSSSVGKFVGYTEHGIKNAERWNNGPEVISSRGEKERYCLNNVGVDVESALTNTQTLRQASLCGAPSWQTCMLVCSVFDFYPKRIKVSWQRDGQEVTSDVTSTDELADGDWYYQIHSHLEYMPKSGEKISCVVEHASLSKPLITDWDPSMPESERNKIAIGTSGLILGLTLSLAGFIYYKRKAQGRILVPTN input pdb

Peptide sequence

NKDYFAVSDGIDVIY

Simulation mc cycles

Peptide secondary structure psipred

CCCCEECCCCCEEEC

Flexible regions

108:B - 18:B

100:A - 19:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.5308	5.30611	24.2648	162
cluster_2.pdb ( medoid)	24.0594	4.57202	11.4874	110
cluster_3.pdb ( medoid)	23.2876	6.52709	28.0731	152
cluster_4.pdb ( medoid)	20.0588	8.22582	27.1611	165
cluster_5.pdb ( medoid)	18.5646	5.76366	14.0743	107
cluster_6.pdb ( medoid)	9.88188	5.36335	18.3991	53
cluster_7.pdb ( medoid)	8.81512	15.2012	48.5092	134
cluster_8.pdb ( medoid)	4.97749	9.64342	43.6708	48
cluster_9.pdb ( medoid)	4.83255	8.48413	17.2806	41
cluster_10.pdb ( medoid)	4.41568	6.34104	20.37	28