CABS-dock: d5a28fea2fadfcd

Project name: d5a28fea2fadfcd

Status: done

submitted: 2026-07-28 09:48:55, status changed: 2026-07-28 11:39:58

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQVFGLNNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.1372	4.59893	23.0719	134
cluster_2.pdb ( medoid)	21.1879	5.75799	33.1378	122
cluster_3.pdb ( medoid)	18.9633	6.59167	31.137	125
cluster_4.pdb ( medoid)	17.096	10.2948	30.2968	176
cluster_5.pdb ( medoid)	10.8802	10.1101	25.6741	110
cluster_6.pdb ( medoid)	8.21909	11.8018	25.4288	97
cluster_7.pdb ( medoid)	6.99152	12.0146	27.9531	84
cluster_8.pdb ( medoid)	6.42858	10.8889	25.8606	70
cluster_9.pdb ( medoid)	4.29005	10.0232	19.3794	43
cluster_10.pdb ( medoid)	3.25015	11.9994	22.0671	39