Project name: d5a28fea2fadfcd

Status: done

submitted: 2026-07-28 09:48:55, status changed: 2026-07-28 11:39:58

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQVFGLNNY
Simulation mc cycles50
Peptide secondary structure psipred CCEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.1372 4.59893 23.0719 134
cluster_2.pdb ( medoid) 21.1879 5.75799 33.1378 122
cluster_3.pdb ( medoid) 18.9633 6.59167 31.137 125
cluster_4.pdb ( medoid) 17.096 10.2948 30.2968 176
cluster_5.pdb ( medoid) 10.8802 10.1101 25.6741 110
cluster_6.pdb ( medoid) 8.21909 11.8018 25.4288 97
cluster_7.pdb ( medoid) 6.99152 12.0146 27.9531 84
cluster_8.pdb ( medoid) 6.42858 10.8889 25.8606 70
cluster_9.pdb ( medoid) 4.29005 10.0232 19.3794 43
cluster_10.pdb ( medoid) 3.25015 11.9994 22.0671 39