CABS-dock: RO33.1

Project name: RO33.1_USP7

Status: done

submitted: 2026-01-12 05:27:10, status changed: 2026-01-12 09:20:47

Project settings

Protein sequence(s)	TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWGARAHSS input pdb
Peptide sequence	KDGANTQVVAKPADAVSTQSAKNPPGA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCEEEECCHHHCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.9488	2.89301	20.1346	104
cluster_2.pdb ( medoid)	17.196	6.9202	32.6251	119
cluster_3.pdb ( medoid)	16.8327	7.78248	17.9356	131
cluster_4.pdb ( medoid)	15.3112	9.5355	31.3329	146
cluster_5.pdb ( medoid)	11.6211	12.8215	40.3537	149
cluster_6.pdb ( medoid)	11.5583	7.35403	33.0765	85
cluster_7.pdb ( medoid)	10.7622	11.1501	31.9468	120
cluster_8.pdb ( medoid)	4.5871	14.8242	36.9579	68
cluster_9.pdb ( medoid)	2.89882	17.9383	33.3744	52
cluster_10.pdb ( medoid)	1.81112	14.3558	29.6425	26