CABS-dock: 251229 IgV_Only

Project name: 251229 IgV_Only_2

Status: done

submitted: 2025-12-29 08:37:44, status changed: 2025-12-29 11:46:43

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence	WHRSYYTWNLNT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.8165	7.49501	22.1211	186
cluster_2.pdb ( medoid)	22.6229	4.02247	12.0535	91
cluster_3.pdb ( medoid)	19.4897	7.02936	16.4834	137
cluster_4.pdb ( medoid)	18.5562	5.92793	19.4016	110
cluster_5.pdb ( medoid)	17.6758	4.63911	15.0521	82
cluster_6.pdb ( medoid)	17.2005	6.16263	15.5874	106
cluster_7.pdb ( medoid)	15.1686	9.0318	19.4899	137
cluster_8.pdb ( medoid)	8.88652	6.7518	13.9475	60
cluster_9.pdb ( medoid)	6.95043	8.34481	16.019	58
cluster_10.pdb ( medoid)	3.61587	9.12644	28.1316	33