Project name: p22CC

Status: done

submitted: 2025-12-22 15:13:30, status changed: 2025-12-23 02:42:06

Project settings
Protein sequence(s) SKHRIEPVCLIIRGSPGTGKSLATGIIARAIADKYHSSVYSLPPDPDHFDGYKQQVVTVMDDLCQNPDGKDMSLFCQMVSTVDFIPPMASLEEKGVSFTSKFVIASTNASNIIVPTVSDSDAIRRRFYMDCDIEVTDSYKTELGRLDAGRAAKLCSENNTANFKRCSPLVCGKAIQLRDRKSKVRYSVDTVVSELIREYNSRSAIGNTIEALFQ input pdb
Peptide sequence ICRVNRNSGSCL
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.6014 4.40538 23.931 126
cluster_2.pdb ( medoid) 26.3243 4.40657 14.7508 116
cluster_3.pdb ( medoid) 17.6306 6.29586 26.9878 111
cluster_4.pdb ( medoid) 11.404 9.38267 20.6735 107
cluster_5.pdb ( medoid) 10.4712 13.1789 36.7652 138
cluster_6.pdb ( medoid) 8.15999 10.4167 29.5067 85
cluster_7.pdb ( medoid) 7.81155 11.2654 29.7606 88
cluster_8.pdb ( medoid) 6.73049 12.9263 28.5412 87
cluster_9.pdb ( medoid) 6.63378 8.89387 22.212 59
cluster_10.pdb ( medoid) 5.7203 14.5097 32.5306 83