CABS-dock: elm1

Project name: elm1

Status: done

submitted: 2026-02-20 11:17:11, status changed: 2026-02-20 13:07:11

Project settings

Protein sequence(s)	TNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQ input pdb
Peptide sequence	AAAPQPKVRLRQEVVSTAGPRRGQRIAVPV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCEEEEEEEEECCCCCCCCEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	17.2117	6.73961	23.2168	116
cluster_2.pdb ( medoid)	16.2498	7.93857	35.2211	129
cluster_3.pdb ( medoid)	12.4705	8.01894	18.236	100
cluster_4.pdb ( medoid)	11.3017	11.2373	27.8645	127
cluster_5.pdb ( medoid)	10.054	9.54843	22.4058	96
cluster_6.pdb ( medoid)	6.80597	14.9869	28.9557	102
cluster_7.pdb ( medoid)	6.70485	16.5552	33.2754	111
cluster_8.pdb ( medoid)	5.7229	8.03789	23.2678	46
cluster_9.pdb ( medoid)	5.50665	15.2543	29.4092	84
cluster_10.pdb ( medoid)	5.14881	17.2855	29.0199	89