Project name: 251229 IgV_Only_9

Status: done

submitted: 2025-12-29 08:41:14, status changed: 2025-12-29 11:45:23

Project settings
Protein sequence(s) AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence WHRSYYTWNLNT
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.4 4.25171 19.9976 125
cluster_2.pdb ( medoid) 21.9545 8.79091 31.0262 193
cluster_3.pdb ( medoid) 20.1424 6.85121 26.5156 138
cluster_4.pdb ( medoid) 19.993 7.4526 33.3563 149
cluster_5.pdb ( medoid) 13.2969 9.92715 22.3422 132
cluster_6.pdb ( medoid) 11.9199 5.78866 15.3608 69
cluster_7.pdb ( medoid) 10.822 2.67972 12.9459 29
cluster_8.pdb ( medoid) 8.59262 10.0086 28.8527 86
cluster_9.pdb ( medoid) 7.28755 6.7238 15.2445 49
cluster_10.pdb ( medoid) 4.17692 7.18233 16.8506 30