CABS-dock: d7e2f494f529b62

Project name: d7e2f494f529b62

Status: done

submitted: 2026-04-02 09:42:20, status changed: 2026-04-02 17:58:58

Project settings

Protein sequence(s)	TAPDNLGKMGIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDGGGSGPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGAYNQSSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP input pdb
Peptide sequence	EARHSGYLPYQMF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	156.845	0.637572	2.24209	100
cluster_2.pdb ( medoid)	67.7646	1.4757	8.38734	100
cluster_3.pdb ( medoid)	38.1055	2.72926	16.7739	104
cluster_4.pdb ( medoid)	18.7575	6.29082	28.3415	118
cluster_5.pdb ( medoid)	18.1708	6.38387	25.4076	116
cluster_6.pdb ( medoid)	17.4929	3.60146	17.9914	63
cluster_7.pdb ( medoid)	16.3498	4.40371	31.6353	72
cluster_8.pdb ( medoid)	14.7109	10.0606	20.1577	148
cluster_9.pdb ( medoid)	11.7815	9.16692	23.054	108
cluster_10.pdb ( medoid)	9.41541	7.54083	13.8121	71