CABS-dock: d8001aec9fdb562

Project name: d8001aec9fdb562

Status: done

submitted: 2026-02-26 13:40:32, status changed: 2026-02-26 16:00:00

Project settings

Protein sequence(s)	PTSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEFNVML input pdb
Peptide sequence	ERLTLPPSEITLL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	45.8724	3.72773	20.9036	171
cluster_2.pdb ( medoid)	34.9519	3.63356	8.81142	127
cluster_3.pdb ( medoid)	24.3651	6.07427	21.9675	148
cluster_4.pdb ( medoid)	17.0006	3.47047	9.61335	59
cluster_5.pdb ( medoid)	12.7176	6.13323	18.4557	78
cluster_6.pdb ( medoid)	10.6978	15.6106	31.6175	167
cluster_7.pdb ( medoid)	10.2158	11.7466	34.9718	120
cluster_8.pdb ( medoid)	6.82072	9.08995	16.4916	62
cluster_9.pdb ( medoid)	5.67354	7.7553	19.2789	44
cluster_10.pdb ( medoid)	2.99958	8.00112	21.7333	24