CABS-dock: d8eb0393174ae9c

Project name: d8eb0393174ae9c

Status: done

submitted: 2026-01-21 11:07:21, status changed: 2026-01-21 21:22:29

Project settings

Protein sequence(s)	VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence	TRSMTSEGLRSSGAMAG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCHHHHHHCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.9569	5.75887	12.3262	161
cluster_2.pdb ( medoid)	27.0286	4.92071	29.0568	133
cluster_3.pdb ( medoid)	21.1599	6.09644	35.8717	129
cluster_4.pdb ( medoid)	17.9488	8.24566	38.3366	148
cluster_5.pdb ( medoid)	13.8341	5.99965	16.6841	83
cluster_6.pdb ( medoid)	12.785	7.58699	27.2779	97
cluster_7.pdb ( medoid)	9.08311	6.0552	12.9426	55
cluster_8.pdb ( medoid)	6.48289	8.63812	20.2076	56
cluster_9.pdb ( medoid)	3.43487	18.6324	44.5485	64
cluster_10.pdb ( medoid)	3.12996	23.6425	46.3897	74