Project name: DGR

Status: done

submitted: 2026-04-18 14:14:19, status changed: 2026-04-18 18:27:12

Project settings
Protein sequence(s) AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNANPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPESRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTE input pdb
Peptide sequence CDGRPDRAC
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 65.7434 1.88612 25.7871 124
cluster_2.pdb ( medoid) 26.8049 5.33485 39.1022 143
cluster_3.pdb ( medoid) 25.1236 6.08989 13.6147 153
cluster_4.pdb ( medoid) 17.4505 6.13162 34.3592 107
cluster_5.pdb ( medoid) 15.3288 7.11078 25.9394 109
cluster_6.pdb ( medoid) 13.4917 6.37428 30.7681 86
cluster_7.pdb ( medoid) 12.5279 5.66736 17.279 71
cluster_8.pdb ( medoid) 7.72745 10.0939 32.1745 78
cluster_9.pdb ( medoid) 7.295 8.49898 36.5608 62
cluster_10.pdb ( medoid) 4.53903 14.7609 33.3032 67