Project name: d99ba01460b427f

Status: done

submitted: 2026-07-08 20:10:12, status changed: 2026-07-09 02:20:40

Project settings
Protein sequence(s) MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD input pdb
Peptide sequence KWYNRKLLDPNKLRWY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.236 4.07281 19.9467 115
cluster_2.pdb ( medoid) 23.885 5.40088 21.2543 129
cluster_3.pdb ( medoid) 15.9785 8.32371 25.7971 133
cluster_4.pdb ( medoid) 12.1385 13.4283 34.468 163
cluster_5.pdb ( medoid) 12.0002 8.08323 17.2366 97
cluster_6.pdb ( medoid) 9.83327 11.2882 25.0573 111
cluster_7.pdb ( medoid) 9.45524 5.28807 12.321 50
cluster_8.pdb ( medoid) 8.32001 11.899 26.5486 99
cluster_9.pdb ( medoid) 7.10011 11.2674 30.5546 80
cluster_10.pdb ( medoid) 2.10505 10.9261 33.0335 23