CABS-dock: d99ba01460b427f

Project name: d99ba01460b427f

Status: done

submitted: 2026-07-08 20:10:12, status changed: 2026-07-09 02:20:40

Project settings

Protein sequence(s)	MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD input pdb
Peptide sequence	KWYNRKLLDPNKLRWY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.236	4.07281	19.9467	115
cluster_2.pdb ( medoid)	23.885	5.40088	21.2543	129
cluster_3.pdb ( medoid)	15.9785	8.32371	25.7971	133
cluster_4.pdb ( medoid)	12.1385	13.4283	34.468	163
cluster_5.pdb ( medoid)	12.0002	8.08323	17.2366	97
cluster_6.pdb ( medoid)	9.83327	11.2882	25.0573	111
cluster_7.pdb ( medoid)	9.45524	5.28807	12.321	50
cluster_8.pdb ( medoid)	8.32001	11.899	26.5486	99
cluster_9.pdb ( medoid)	7.10011	11.2674	30.5546	80
cluster_10.pdb ( medoid)	2.10505	10.9261	33.0335	23