CABS-dock: d9e6ca7eeddf044

Project name: d9e6ca7eeddf044

Status: done

submitted: 2026-03-14 06:57:48, status changed: 2026-03-14 12:50:59

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRWKPVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.2834	5.49724	39.8155	117
cluster_2.pdb ( medoid)	20.9507	6.10959	31.4233	128
cluster_3.pdb ( medoid)	12.7516	10.3516	26.0641	132
cluster_4.pdb ( medoid)	10.7519	9.30064	30.6875	100
cluster_5.pdb ( medoid)	9.82442	8.85549	30.5293	87
cluster_6.pdb ( medoid)	7.95174	16.4744	46.0346	131
cluster_7.pdb ( medoid)	7.79075	10.6537	23.1127	83
cluster_8.pdb ( medoid)	6.6369	15.218	36.9906	101
cluster_9.pdb ( medoid)	5.53837	9.38905	35.7055	52
cluster_10.pdb ( medoid)	3.39182	20.343	45.5463	69