Project name: da7ac6501df25d

Status: done

submitted: 2026-07-16 14:02:03, status changed: 2026-07-17 01:03:07

Project settings
Protein sequence(s) DKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALDKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL input pdb
Peptide sequence VLGYMQLR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 57.5709 2.69233 9.9135 155
cluster_2.pdb ( medoid) 27.5684 6.16649 51.1576 170
cluster_3.pdb ( medoid) 25.2443 8.43755 52.0303 213
cluster_4.pdb ( medoid) 15.5439 5.14671 24.2472 80
cluster_5.pdb ( medoid) 12.0702 5.71657 36.2243 69
cluster_6.pdb ( medoid) 8.59909 14.1875 49.5906 122
cluster_7.pdb ( medoid) 4.46363 14.3381 48.7794 64
cluster_8.pdb ( medoid) 3.98854 12.7866 35.7635 51
cluster_9.pdb ( medoid) 3.62502 11.5861 33.0204 42
cluster_10.pdb ( medoid) 1.43185 23.7455 58.4527 34