CABS-dock: da7ac6501df25d

Project name: da7ac6501df25d

Status: done

submitted: 2026-07-16 14:02:03, status changed: 2026-07-17 01:03:07

Project settings

Protein sequence(s)	DKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALDKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL input pdb
Peptide sequence	VLGYMQLR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	57.5709	2.69233	9.9135	155
cluster_2.pdb ( medoid)	27.5684	6.16649	51.1576	170
cluster_3.pdb ( medoid)	25.2443	8.43755	52.0303	213
cluster_4.pdb ( medoid)	15.5439	5.14671	24.2472	80
cluster_5.pdb ( medoid)	12.0702	5.71657	36.2243	69
cluster_6.pdb ( medoid)	8.59909	14.1875	49.5906	122
cluster_7.pdb ( medoid)	4.46363	14.3381	48.7794	64
cluster_8.pdb ( medoid)	3.98854	12.7866	35.7635	51
cluster_9.pdb ( medoid)	3.62502	11.5861	33.0204	42
cluster_10.pdb ( medoid)	1.43185	23.7455	58.4527	34