CABS-dock: da7d028724efcd9

Project name: da7d028724efcd9

Status: done

submitted: 2025-05-30 09:58:07, status changed: 2025-05-30 14:00:34

Project settings

Protein sequence(s)	QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV input pdb
Peptide sequence	KEEDKHLKFRISHEL
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.6488	4.88676	18.3628	140
cluster_2.pdb ( medoid)	24.4863	4.77819	17.6859	117
cluster_3.pdb ( medoid)	21.0508	8.3132	40.4418	175
cluster_4.pdb ( medoid)	15.7014	6.87835	27.874	108
cluster_5.pdb ( medoid)	15.656	8.1119	39.4156	127
cluster_6.pdb ( medoid)	14.6984	7.34776	28.4117	108
cluster_7.pdb ( medoid)	12.7171	7.6275	21.2877	97
cluster_8.pdb ( medoid)	4.57212	7.65508	14.7591	35
cluster_9.pdb ( medoid)	4.28171	10.2763	32.3149	44
cluster_10.pdb ( medoid)	4.1418	11.8306	24.8935	49