CABS-dock: LexA-Cs8

Project name: LexA-Cs8

Status: done

submitted: 2026-01-10 14:53:15, status changed: 2026-01-10 18:11:07

Project settings

Protein sequence(s)	EEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVVIRNGDWL input pdb
Peptide sequence	IVKVQANQHKHIAGLKE
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEECCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.369	7.51264	31.2817	138
cluster_2.pdb ( medoid)	15.1179	7.07771	38.6564	107
cluster_3.pdb ( medoid)	13.3044	11.3496	39.9201	151
cluster_4.pdb ( medoid)	13.2659	11.1564	33.3468	148
cluster_5.pdb ( medoid)	11.4297	12.2488	33.4517	140
cluster_6.pdb ( medoid)	10.5137	5.04102	13.9852	53
cluster_7.pdb ( medoid)	9.21044	12.2687	28.2978	113
cluster_8.pdb ( medoid)	8.17353	8.68658	27.1019	71
cluster_9.pdb ( medoid)	4.87913	10.2477	31.1224	50
cluster_10.pdb ( medoid)	2.89572	10.0148	27.7352	29