Project name: 1le3

Status: done

submitted: 2025-12-12 13:50:03, status changed: 2025-12-12 17:26:33

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence GEWTWDDATKTWTWTE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 41.3363 2.46757 18.0872 102
cluster_2.pdb ( medoid) 27.6591 3.94083 31.0281 109
cluster_3.pdb ( medoid) 18.5285 6.85431 22.9177 127
cluster_4.pdb ( medoid) 14.649 6.75814 20.7677 99
cluster_5.pdb ( medoid) 11.3429 15.5163 35.8071 176
cluster_6.pdb ( medoid) 8.68668 12.2026 31.5357 106
cluster_7.pdb ( medoid) 7.42469 12.7951 27.5385 95
cluster_8.pdb ( medoid) 4.67276 14.9805 27.663 70
cluster_9.pdb ( medoid) 4.64087 14.006 29.4283 65
cluster_10.pdb ( medoid) 4.2381 12.0337 32.644 51