Project name: db73c92c5cf1b82

Status: done

submitted: 2026-03-12 20:05:53, status changed: 2026-03-13 04:32:42

Project settings
Protein sequence(s) APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA input pdb
Peptide sequence LISDAELEAIFEAELDC
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.3167 6.21873 18.2143 145
cluster_2.pdb ( medoid) 21.2347 7.86449 19.0985 167
cluster_3.pdb ( medoid) 20.3401 4.57224 26.3002 93
cluster_4.pdb ( medoid) 18.3892 6.57994 44.0586 121
cluster_5.pdb ( medoid) 18.0007 5.722 43.3275 103
cluster_6.pdb ( medoid) 10.0707 9.13544 19.1695 92
cluster_7.pdb ( medoid) 9.89908 6.66729 17.4223 66
cluster_8.pdb ( medoid) 9.82612 7.63271 25.3239 75
cluster_9.pdb ( medoid) 6.82236 10.1138 47.2172 69
cluster_10.pdb ( medoid) 5.84578 11.8034 30.395 69