Project name: dbe8376dba44c9e

Status: done

submitted: 2026-01-14 05:35:57, status changed: 2026-01-14 18:16:38

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence RVIVQCFGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.5145 3.25232 28.2672 109
cluster_2.pdb ( medoid) 19.3036 6.47548 35.8592 125
cluster_3.pdb ( medoid) 11.7255 11.6839 40.8706 137
cluster_4.pdb ( medoid) 11.6514 11.2433 50.6828 131
cluster_5.pdb ( medoid) 10.6356 6.95779 19.4642 74
cluster_6.pdb ( medoid) 7.91564 15.2862 53.0182 121
cluster_7.pdb ( medoid) 7.81655 11.7699 28.4206 92
cluster_8.pdb ( medoid) 7.47302 8.56414 31.9718 64
cluster_9.pdb ( medoid) 6.57385 8.06225 25.3025 53
cluster_10.pdb ( medoid) 2.65176 27.1518 59.2017 72