CABS-dock: 2UV0_Second

Project name: 2UV0_Second_Sequence

Status: done

submitted: 2026-04-19 12:55:41, status changed: 2026-04-19 13:34:06

Project settings

Protein sequence(s)	DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENAEANRFMESVLPTLWMLKDYALQSGAGLAFE input pdb
Peptide sequence	RGGRLYRRRFVVGR
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCEEEEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	56.6485	1.6064	4.50623	91
cluster_2.pdb ( medoid)	25.629	3.94084	16.4914	101
cluster_3.pdb ( medoid)	14.9868	13.1449	25.7336	197
cluster_4.pdb ( medoid)	12.2551	10.1182	38.0895	124
cluster_5.pdb ( medoid)	11.6424	8.67517	26.7541	101
cluster_6.pdb ( medoid)	10.957	5.47596	15.7191	60
cluster_7.pdb ( medoid)	7.84713	16.3117	49.6966	128
cluster_8.pdb ( medoid)	7.02735	8.39577	18.4835	59
cluster_9.pdb ( medoid)	4.88927	8.9993	21.0067	44
cluster_10.pdb ( medoid)	2.6434	15.8886	31.1288	42