Project name: 2UV0_Second_Sequence

Status: done

submitted: 2026-04-19 12:55:41, status changed: 2026-04-19 13:34:06

Project settings
Protein sequence(s) DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENAEANRFMESVLPTLWMLKDYALQSGAGLAFE input pdb
Peptide sequence RGGRLYRRRFVVGR
Simulation mc cycles5
Peptide secondary structure psipred CCCCEEEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 56.6485 1.6064 4.50623 91
cluster_2.pdb ( medoid) 25.629 3.94084 16.4914 101
cluster_3.pdb ( medoid) 14.9868 13.1449 25.7336 197
cluster_4.pdb ( medoid) 12.2551 10.1182 38.0895 124
cluster_5.pdb ( medoid) 11.6424 8.67517 26.7541 101
cluster_6.pdb ( medoid) 10.957 5.47596 15.7191 60
cluster_7.pdb ( medoid) 7.84713 16.3117 49.6966 128
cluster_8.pdb ( medoid) 7.02735 8.39577 18.4835 59
cluster_9.pdb ( medoid) 4.88927 8.9993 21.0067 44
cluster_10.pdb ( medoid) 2.6434 15.8886 31.1288 42