CABS-dock: dc39342ccda4e8b

Project name: dc39342ccda4e8b

Status: done

submitted: 2026-04-14 06:18:08, status changed: 2026-04-14 14:40:45

Project settings

Protein sequence(s)	TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEGYTLTWDNGLVLYSN input pdb
Peptide sequence	VVIPIELR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	41.6223	4.5168	19.3226	188
cluster_2.pdb ( medoid)	37.9461	4.00568	10.4341	152
cluster_3.pdb ( medoid)	23.0673	5.20217	36.4394	120
cluster_4.pdb ( medoid)	17.0536	4.74974	11.9364	81
cluster_5.pdb ( medoid)	16.0626	10.0855	58.6141	162
cluster_6.pdb ( medoid)	14.3174	5.72731	30.2517	82
cluster_7.pdb ( medoid)	3.9407	11.1655	27.4808	44
cluster_8.pdb ( medoid)	3.5731	12.0344	22.9191	43
cluster_9.pdb ( medoid)	3.38138	19.8144	44.0806	67
cluster_10.pdb ( medoid)	3.30933	18.4327	43.2448	61