Project name: dc39342ccda4e8b

Status: done

submitted: 2026-04-14 06:18:08, status changed: 2026-04-14 14:40:45

Project settings
Protein sequence(s) TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEGYTLTWDNGLVLYSN input pdb
Peptide sequence VVIPIELR
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 41.6223 4.5168 19.3226 188
cluster_2.pdb ( medoid) 37.9461 4.00568 10.4341 152
cluster_3.pdb ( medoid) 23.0673 5.20217 36.4394 120
cluster_4.pdb ( medoid) 17.0536 4.74974 11.9364 81
cluster_5.pdb ( medoid) 16.0626 10.0855 58.6141 162
cluster_6.pdb ( medoid) 14.3174 5.72731 30.2517 82
cluster_7.pdb ( medoid) 3.9407 11.1655 27.4808 44
cluster_8.pdb ( medoid) 3.5731 12.0344 22.9191 43
cluster_9.pdb ( medoid) 3.38138 19.8144 44.0806 67
cluster_10.pdb ( medoid) 3.30933 18.4327 43.2448 61