Project name: 1kfp

Status: done

submitted: 2025-12-12 13:36:13, status changed: 2025-12-12 15:11:52

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence QCRRLCYKQRCVTYCRGR
Simulation mc cycles50
Peptide secondary structure psipred CCCCEEECCCCCHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.3629 2.64208 16.0082 104
cluster_2.pdb ( medoid) 16.5027 8.36226 25.4984 138
cluster_3.pdb ( medoid) 12.1024 11.2374 37.5355 136
cluster_4.pdb ( medoid) 11.9735 8.76935 25.7549 105
cluster_5.pdb ( medoid) 9.60357 14.1614 28.4483 136
cluster_6.pdb ( medoid) 9.10057 9.34007 33.5366 85
cluster_7.pdb ( medoid) 7.16111 11.8697 25.0749 85
cluster_8.pdb ( medoid) 4.85632 12.355 26.9409 60
cluster_9.pdb ( medoid) 4.586 19.4069 32.3206 89
cluster_10.pdb ( medoid) 4.19473 14.7805 30.9058 62