CABS-dock: dc8b3e0223ea903

Project name: dc8b3e0223ea903

Status: done

submitted: 2026-05-03 23:31:44, status changed: 2026-05-04 01:18:58

Project settings

Protein sequence(s)	TVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE input pdb
Peptide sequence	TSVGHMPSTKEEGRDFEEA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCHHHCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.5745	4.63237	17.9985	137
cluster_2.pdb ( medoid)	23.4931	7.44898	17.7207	175
cluster_3.pdb ( medoid)	22.5102	6.17497	17.3508	139
cluster_4.pdb ( medoid)	14.4579	7.53914	17.2464	109
cluster_5.pdb ( medoid)	14.4205	6.10241	24.8417	88
cluster_6.pdb ( medoid)	9.88716	6.27076	22.986	62
cluster_7.pdb ( medoid)	9.58142	10.75	21.4572	103
cluster_8.pdb ( medoid)	7.86387	6.86684	15.0975	54
cluster_9.pdb ( medoid)	7.29275	11.1069	22.323	81
cluster_10.pdb ( medoid)	6.54809	7.94124	21.7603	52