Project name: dd2646dabf8f406

Status: done

submitted: 2026-03-09 08:47:21, status changed: 2026-03-09 14:36:53

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence VQLFGDSNY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.3822 6.29964 30.4936 141
cluster_2.pdb ( medoid) 21.6279 6.42687 21.9093 139
cluster_3.pdb ( medoid) 16.2943 7.97825 47.3054 130
cluster_4.pdb ( medoid) 14.629 9.22822 32.6857 135
cluster_5.pdb ( medoid) 8.84923 12.6565 42.6886 112
cluster_6.pdb ( medoid) 6.14909 13.6606 26.8475 84
cluster_7.pdb ( medoid) 6.03512 10.2732 23.3983 62
cluster_8.pdb ( medoid) 4.33104 11.5446 22.61 50
cluster_9.pdb ( medoid) 4.26854 16.8676 63.4089 72
cluster_10.pdb ( medoid) 4.14109 18.1112 40.3982 75