Project name: dd90114fb86d2d5

Status: done

submitted: 2025-04-16 12:53:18, status changed: 2025-04-17 02:34:16

Project settings
Protein sequence(s) SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS input pdb
Peptide sequence EEEDEFYQTTYGGFTEESGDDEYQGD
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.2639 4.73572 11.4585 167
cluster_2.pdb ( medoid) 34.8465 3.38628 23.0702 118
cluster_3.pdb ( medoid) 15.3945 6.6907 22.3343 103
cluster_4.pdb ( medoid) 15.1323 8.1944 32.8648 124
cluster_5.pdb ( medoid) 12.0245 8.15006 30.5012 98
cluster_6.pdb ( medoid) 10.1676 8.75331 22.651 89
cluster_7.pdb ( medoid) 9.88347 11.3321 27.0371 112
cluster_8.pdb ( medoid) 8.36582 8.96505 22.0739 75
cluster_9.pdb ( medoid) 6.15007 11.7072 29.3139 72
cluster_10.pdb ( medoid) 3.23289 12.9915 28.4653 42