CABS-dock: raf_mek

Project name: raf_mek_monomer-7

Status: done

submitted: 2026-01-16 18:21:33, status changed: 2026-01-17 12:15:28

Project settings

Protein sequence(s)	LKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAEERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIDWEIPDGQITVGQRIGGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARRQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP input pdb
Peptide sequence	KTRHVNILLFM
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	31.3374	3.574	14.0414	112
cluster_2.pdb ( medoid)	30.4229	5.29207	19.5025	161
cluster_3.pdb ( medoid)	20.2149	6.18356	21.4295	125
cluster_4.pdb ( medoid)	16.0925	5.40623	48.4031	87
cluster_5.pdb ( medoid)	15.8014	6.89812	25.4574	109
cluster_6.pdb ( medoid)	12.6934	9.37494	30.1554	119
cluster_7.pdb ( medoid)	12.008	2.6649	20.8865	32
cluster_8.pdb ( medoid)	11.9193	13.0042	35.2354	155
cluster_9.pdb ( medoid)	4.39668	15.9211	39.5513	70
cluster_10.pdb ( medoid)	2.90223	10.3369	22.2526	30