CABS-dock: de3c9be939d60a6

Project name: de3c9be939d60a6

Status: done

submitted: 2026-01-22 12:57:51, status changed: 2026-01-22 14:47:50

Project settings

Protein sequence(s)	GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence	ASSDGGVRAAKETGV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.6046	6.16434	20.0899	164
cluster_2.pdb ( medoid)	24.856	5.59221	17.454	139
cluster_3.pdb ( medoid)	14.4455	7.8917	24.6381	114
cluster_4.pdb ( medoid)	13.6402	10.4837	26.4287	143
cluster_5.pdb ( medoid)	10.2342	7.42609	17.5548	76
cluster_6.pdb ( medoid)	9.74836	11.3865	20.5979	111
cluster_7.pdb ( medoid)	9.70045	4.43278	9.99551	43
cluster_8.pdb ( medoid)	9.07522	8.15407	20.0654	74
cluster_9.pdb ( medoid)	6.9675	12.4865	26.6763	87
cluster_10.pdb ( medoid)	3.6401	13.4612	28.1872	49