CABS-dock: de51bc8105ada8a

Project name: de51bc8105ada8a

Status: done

submitted: 2026-03-13 05:45:38, status changed: 2026-03-13 18:35:45

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRMKWKVQLFGSNDAKK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.8103	6.46128	30.0985	128
cluster_2.pdb ( medoid)	14.7322	7.19513	37.4266	106
cluster_3.pdb ( medoid)	14.492	8.55646	52.7703	124
cluster_4.pdb ( medoid)	11.9934	12.0066	42.8397	144
cluster_5.pdb ( medoid)	10.0634	12.4213	48.8367	125
cluster_6.pdb ( medoid)	6.74909	19.8545	59.6011	134
cluster_7.pdb ( medoid)	5.38639	12.6244	46.3673	68
cluster_8.pdb ( medoid)	4.56011	16.8856	37.8297	77
cluster_9.pdb ( medoid)	3.82413	18.3048	50.0216	70
cluster_10.pdb ( medoid)	1.03382	23.2148	56.6239	24