CABS-dock: K1.2

Project name: K1.2_USP7

Status: done

submitted: 2026-01-12 05:26:08, status changed: 2026-01-12 09:20:13

Project settings

Protein sequence(s)	TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWGARAHSS input pdb
Peptide sequence	GTSGTSGTSGPSGPSGTSPSSRSNTLPR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.3051	3.24275	32.1448	108
cluster_2.pdb ( medoid)	16.6479	6.30711	32.2106	105
cluster_3.pdb ( medoid)	12.7867	9.15012	22.5047	117
cluster_4.pdb ( medoid)	12.538	11.0065	32.314	138
cluster_5.pdb ( medoid)	12.4058	10.5596	26.7384	131
cluster_6.pdb ( medoid)	11.387	12.119	24.5178	138
cluster_7.pdb ( medoid)	11.1719	11.4573	31.7152	128
cluster_8.pdb ( medoid)	5.33223	9.75202	25.9301	52
cluster_9.pdb ( medoid)	3.62941	13.2253	31.5059	48
cluster_10.pdb ( medoid)	3.34194	10.473	24.6721	35