CABS-dock: df768c3b8644564

Project name: df768c3b8644564

Status: done

submitted: 2026-07-27 05:29:20, status changed: 2026-07-27 07:21:43

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRVIVQVQSGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.3105	4.12821	28.7981	121
cluster_2.pdb ( medoid)	23.6941	4.93794	32.3135	117
cluster_3.pdb ( medoid)	19.4258	6.53771	32.4116	127
cluster_4.pdb ( medoid)	12.5965	9.92338	47.8825	125
cluster_5.pdb ( medoid)	9.52331	10.9206	31.2951	104
cluster_6.pdb ( medoid)	7.5411	13.3933	33.7424	101
cluster_7.pdb ( medoid)	6.62992	12.6698	41.3201	84
cluster_8.pdb ( medoid)	5.65172	12.5626	41.6955	71
cluster_9.pdb ( medoid)	4.85783	16.4683	53.6315	80
cluster_10.pdb ( medoid)	3.84367	18.2118	51.5185	70