Project name: e00e560bd70a29d

Status: done

submitted: 2026-01-11 16:17:27, status changed: 2026-01-11 19:29:34

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPANSWISIANSEAIQIGHGNIITRQTVMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence RVIVQVGSNCFR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 47.4941 2.56874 5.27332 122
cluster_2.pdb ( medoid) 44.5002 2.92134 12.3379 130
cluster_3.pdb ( medoid) 39.8631 3.01031 29.1812 120
cluster_4.pdb ( medoid) 36.2324 3.75355 35.7634 136
cluster_5.pdb ( medoid) 33.3478 4.46806 9.35355 149
cluster_6.pdb ( medoid) 17.7747 5.68223 18.4978 101
cluster_7.pdb ( medoid) 15.6105 4.48417 23.2198 70
cluster_8.pdb ( medoid) 5.45727 13.9264 42.0084 76
cluster_9.pdb ( medoid) 4.44442 11.2501 32.6399 50
cluster_10.pdb ( medoid) 3.2246 14.2654 37.9368 46