Project name: RecA-Cs6

Status: done

submitted: 2026-01-10 14:48:54, status changed: 2026-01-10 18:01:43

Project settings
Protein sequence(s) EGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVVIRNGDWL input pdb
Peptide sequence QAIIHNEKVQAHGKKVL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCHHHHHCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 70.5351 1.3752 2.38999 97
cluster_2.pdb ( medoid) 34.0747 3.08147 26.4528 105
cluster_3.pdb ( medoid) 21.6942 4.79392 22.4277 104
cluster_4.pdb ( medoid) 14.034 8.90696 34.8318 125
cluster_5.pdb ( medoid) 13.7567 9.37723 34.6566 129
cluster_6.pdb ( medoid) 12.3296 7.94835 20.9675 98
cluster_7.pdb ( medoid) 10.5309 12.8195 25.9147 135
cluster_8.pdb ( medoid) 8.09063 9.02278 17.6329 73
cluster_9.pdb ( medoid) 6.91883 13.008 32.0068 90
cluster_10.pdb ( medoid) 4.36634 10.0771 30.9999 44