CABS-dock: SWEETY82

Project name: SWEETY82

Status: done

submitted: 2025-11-12 09:48:42, status changed: 2025-11-12 15:32:39

Project settings

Protein sequence(s)	IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE input pdb
Peptide sequence	GVVIADTGSTGVGTAAGV
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEECCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.9341	5.26238	21.8042	147
cluster_2.pdb ( medoid)	27.0331	2.36747	10.39	64
cluster_3.pdb ( medoid)	23.8556	3.85654	17.7631	92
cluster_4.pdb ( medoid)	23.7656	6.43789	23.4864	153
cluster_5.pdb ( medoid)	16.4244	6.88002	20.597	113
cluster_6.pdb ( medoid)	16.1417	3.53122	12.9832	57
cluster_7.pdb ( medoid)	15.891	6.92215	35.8431	110
cluster_8.pdb ( medoid)	12.5795	10.4138	24.5753	131
cluster_9.pdb ( medoid)	10.3546	7.9192	23.5464	82
cluster_10.pdb ( medoid)	4.76674	10.6991	20.0406	51