Project name: e17e627e23cd1fd

Status: done

submitted: 2026-01-19 17:35:56, status changed: 2026-01-19 20:44:26

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RVIFVQCGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 17.7633 9.28879 28.1837 165
cluster_2.pdb ( medoid) 16.9839 9.1263 36.5659 155
cluster_3.pdb ( medoid) 15.7634 9.38881 33.392 148
cluster_4.pdb ( medoid) 9.98007 10.521 28.9882 105
cluster_5.pdb ( medoid) 6.58645 13.2089 35.3538 87
cluster_6.pdb ( medoid) 6.44629 12.4102 27.9282 80
cluster_7.pdb ( medoid) 4.98136 16.6621 36.3421 83
cluster_8.pdb ( medoid) 4.97204 12.872 24.9105 64
cluster_9.pdb ( medoid) 3.68797 16.8114 34.2395 62
cluster_10.pdb ( medoid) 3.20935 15.8911 33.7752 51