CABS-dock: e17e627e23cd1fd

Project name: e17e627e23cd1fd

Status: done

submitted: 2026-01-19 17:35:56, status changed: 2026-01-19 20:44:26

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RVIFVQCGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	17.7633	9.28879	28.1837	165
cluster_2.pdb ( medoid)	16.9839	9.1263	36.5659	155
cluster_3.pdb ( medoid)	15.7634	9.38881	33.392	148
cluster_4.pdb ( medoid)	9.98007	10.521	28.9882	105
cluster_5.pdb ( medoid)	6.58645	13.2089	35.3538	87
cluster_6.pdb ( medoid)	6.44629	12.4102	27.9282	80
cluster_7.pdb ( medoid)	4.98136	16.6621	36.3421	83
cluster_8.pdb ( medoid)	4.97204	12.872	24.9105	64
cluster_9.pdb ( medoid)	3.68797	16.8114	34.2395	62
cluster_10.pdb ( medoid)	3.20935	15.8911	33.7752	51