CABS-dock: e1db3d358c368e4

Project name: e1db3d358c368e4

Status: done

submitted: 2025-12-22 09:02:52, status changed: 2025-12-22 11:26:06

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	RRNNVFVQCGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.0916	2.83616	11.9508	74
cluster_2.pdb ( medoid)	23.5285	3.69765	13.4835	87
cluster_3.pdb ( medoid)	22.1051	5.60957	11.1156	124
cluster_4.pdb ( medoid)	21.5238	5.99338	18.6813	129
cluster_5.pdb ( medoid)	21.4166	2.28794	22.7765	49
cluster_6.pdb ( medoid)	19.175	6.25815	18.0385	120
cluster_7.pdb ( medoid)	18.2945	7.70723	27.2646	141
cluster_8.pdb ( medoid)	16.1491	6.43998	17.1877	104
cluster_9.pdb ( medoid)	13.3331	7.95012	18.2978	106
cluster_10.pdb ( medoid)	7.04957	9.36228	19.2424	66