CABS-dock: pipi

Project name: pipi

Status: done

submitted: 2026-03-09 11:46:12, status changed: 2026-03-09 14:19:28

Project settings

Protein sequence(s)	KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV input pdb
Peptide sequence	VHFKAG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.8078	5.95724	21.098	118
cluster_2.pdb ( medoid)	18.1698	10.8421	34.3068	197
cluster_3.pdb ( medoid)	16.0244	8.61189	20.6968	138
cluster_4.pdb ( medoid)	14.7557	7.86139	30.2351	116
cluster_5.pdb ( medoid)	14.2228	9.14025	30.5615	130
cluster_6.pdb ( medoid)	14.1174	3.82507	12.1019	54
cluster_7.pdb ( medoid)	12.2436	4.90053	10.2642	60
cluster_8.pdb ( medoid)	8.55638	8.06416	20.3142	69
cluster_9.pdb ( medoid)	7.07044	10.0418	28.3433	71
cluster_10.pdb ( medoid)	3.83026	12.2707	31.3398	47