Project name: e2291c998adac2

Status: done

submitted: 2026-01-14 05:38:07, status changed: 2026-01-14 08:48:34

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RVIVQCFGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.5436 4.93275 22.5415 126
cluster_2.pdb ( medoid) 17.5892 7.1635 24.1328 126
cluster_3.pdb ( medoid) 17.0542 9.3232 33.7145 159
cluster_4.pdb ( medoid) 11.3313 10.8549 31.8897 123
cluster_5.pdb ( medoid) 10.727 11.8393 27.8972 127
cluster_6.pdb ( medoid) 6.39247 13.2969 34.2518 85
cluster_7.pdb ( medoid) 5.50198 11.8139 23.9633 65
cluster_8.pdb ( medoid) 5.48906 14.7566 40.5095 81
cluster_9.pdb ( medoid) 3.74248 14.429 29.4368 54
cluster_10.pdb ( medoid) 3.57396 15.1093 32.6022 54