CABS-dock: e32cb5496115252

Project name: e32cb5496115252

Status: done

submitted: 2025-12-22 08:59:19, status changed: 2025-12-22 11:15:37

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RVISNFVQCGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.431	7.23727	26.6143	213
cluster_2.pdb ( medoid)	28.2325	6.62356	18.7697	187
cluster_3.pdb ( medoid)	13.7217	5.97593	17.3058	82
cluster_4.pdb ( medoid)	13.7184	8.1642	22.8592	112
cluster_5.pdb ( medoid)	8.97642	13.1455	31.9284	118
cluster_6.pdb ( medoid)	8.32839	11.1666	25.9252	93
cluster_7.pdb ( medoid)	6.84259	5.6996	21.1366	39
cluster_8.pdb ( medoid)	6.55201	10.3785	21.8351	68
cluster_9.pdb ( medoid)	2.61827	17.1869	32.4332	45
cluster_10.pdb ( medoid)	2.46516	17.4431	30.8102	43