CABS-dock: e34983e7d8fc91d

Project name: e34983e7d8fc91d

Status: done

submitted: 2026-01-14 13:56:03, status changed: 2026-01-15 01:22:17

Project settings

Protein sequence(s)	QIIPSNTTSPPTNSTSPPTNATAPAPSPTNTITKAANITKPGCPKQCGNVTVPYPFGIGSGCALDPMFEIDCNVTTPFIGNIQIYDISDAEMRISNFINTKCYSQTGVLIQDIPSWITLGTKSPYTFSTLNRFIVVGCDDGAIVSGNNFANGCPSLCTSTNDIVKGKCMGFGCCQITIPKGLKFFNTTMVTTRNHSLIWSFNPCGHSFLGEASRFEFQGIEDLSDVNFANKIRNNVPIVLDWAIGNLSCVEARKSNDYACLNNSQCVDSDTSLGGYRCSCNSGYIGNPYIGSGCQDIDECADPNTNSCEKICTNIPGSYNCSCPEGYTGDGRKNGRGCIAPNSNSEFPWIK input pdb
Peptide sequence	KDVNFGTPDSTVQNPQDASKPNDSQSNIAK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCCCCCCCCCHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.75	1.34969	12.2292	55
cluster_2.pdb ( medoid)	34.4444	2.90323	5.66131	100
cluster_3.pdb ( medoid)	21.4397	2.28548	14.5121	49
cluster_4.pdb ( medoid)	16.2949	10.0645	28.7416	164
cluster_5.pdb ( medoid)	13.5899	6.32823	30.3794	86
cluster_6.pdb ( medoid)	12.5252	8.06374	23.3355	101
cluster_7.pdb ( medoid)	9.21175	10.4215	23.4648	96
cluster_8.pdb ( medoid)	4.20848	11.6432	33.9388	49
cluster_9.pdb ( medoid)	3.31195	19.9278	44.8418	66
cluster_10.pdb ( medoid)	0.668135	19.4572	38.804	13