Project name: e34983e7d8fc91d

Status: done

submitted: 2026-01-14 13:56:03, status changed: 2026-01-15 01:22:17

Project settings
Protein sequence(s) QIIPSNTTSPPTNSTSPPTNATAPAPSPTNTITKAANITKPGCPKQCGNVTVPYPFGIGSGCALDPMFEIDCNVTTPFIGNIQIYDISDAEMRISNFINTKCYSQTGVLIQDIPSWITLGTKSPYTFSTLNRFIVVGCDDGAIVSGNNFANGCPSLCTSTNDIVKGKCMGFGCCQITIPKGLKFFNTTMVTTRNHSLIWSFNPCGHSFLGEASRFEFQGIEDLSDVNFANKIRNNVPIVLDWAIGNLSCVEARKSNDYACLNNSQCVDSDTSLGGYRCSCNSGYIGNPYIGSGCQDIDECADPNTNSCEKICTNIPGSYNCSCPEGYTGDGRKNGRGCIAPNSNSEFPWIK input pdb
Peptide sequence KDVNFGTPDSTVQNPQDASKPNDSQSNIAK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCCCCCCCCCHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.75 1.34969 12.2292 55
cluster_2.pdb ( medoid) 34.4444 2.90323 5.66131 100
cluster_3.pdb ( medoid) 21.4397 2.28548 14.5121 49
cluster_4.pdb ( medoid) 16.2949 10.0645 28.7416 164
cluster_5.pdb ( medoid) 13.5899 6.32823 30.3794 86
cluster_6.pdb ( medoid) 12.5252 8.06374 23.3355 101
cluster_7.pdb ( medoid) 9.21175 10.4215 23.4648 96
cluster_8.pdb ( medoid) 4.20848 11.6432 33.9388 49
cluster_9.pdb ( medoid) 3.31195 19.9278 44.8418 66
cluster_10.pdb ( medoid) 0.668135 19.4572 38.804 13