CABS-dock: e3e32978d35d6e0

Project name: e3e32978d35d6e0

Status: done

submitted: 2026-07-23 10:36:26, status changed: 2026-07-23 12:31:14

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRVIVFVQCGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	16.9961	9.41395	32.3513	160
cluster_2.pdb ( medoid)	15.8888	3.08393	18.2719	49
cluster_3.pdb ( medoid)	11.3237	11.0388	34.9177	125
cluster_4.pdb ( medoid)	11.2843	9.30493	32.9895	105
cluster_5.pdb ( medoid)	11.0999	11.6217	31.9486	129
cluster_6.pdb ( medoid)	9.78823	7.45794	38.2923	73
cluster_7.pdb ( medoid)	9.46762	14.8929	45.4991	141
cluster_8.pdb ( medoid)	7.62733	10.2264	29.0894	78
cluster_9.pdb ( medoid)	6.38572	14.7203	33.7477	94
cluster_10.pdb ( medoid)	3.64349	12.6253	36.1746	46