Project name: 260628_LepB_3A_3

Status: done

submitted: 2026-06-28 04:14:00, status changed: 2026-06-28 08:21:04

Project settings
Protein sequence(s) RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence MLSFAADAAA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.5861 4.79096 51.9807 113
cluster_2.pdb ( medoid) 18.5657 5.87103 25.602 109
cluster_3.pdb ( medoid) 17.2405 7.42438 23.6654 128
cluster_4.pdb ( medoid) 16.9416 9.38516 37.2756 159
cluster_5.pdb ( medoid) 13.1841 8.8743 48.4421 117
cluster_6.pdb ( medoid) 7.50246 11.7295 33.609 88
cluster_7.pdb ( medoid) 6.06317 17.6475 44.7561 107
cluster_8.pdb ( medoid) 5.52204 13.9441 35.8047 77
cluster_9.pdb ( medoid) 3.19789 13.4464 35.3051 43
cluster_10.pdb ( medoid) 2.78645 21.1739 56.8832 59