CABS-dock: 2rtv

Project name: 2rtv

Status: done

submitted: 2025-12-12 16:17:26, status changed: 2025-12-12 18:44:03

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	SFGDGFADF
Simulation mc cycles	50
Peptide secondary structure	CCCCHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.7514	5.09444	24.3131	121
cluster_2.pdb ( medoid)	18.0099	8.21771	25.7459	148
cluster_3.pdb ( medoid)	16.6673	10.1996	30.576	170
cluster_4.pdb ( medoid)	15.6753	12.2485	34.5757	192
cluster_5.pdb ( medoid)	8.51862	12.7955	27.3189	109
cluster_6.pdb ( medoid)	4.57945	9.60813	25.9348	44
cluster_7.pdb ( medoid)	4.51877	9.29457	20.4236	42
cluster_8.pdb ( medoid)	4.40214	11.5853	29.7022	51
cluster_9.pdb ( medoid)	4.38477	10.0347	30.5302	44
cluster_10.pdb ( medoid)	4.32828	18.252	41.2058	79