Project name: e4c233063d9c0d1

Status: done

submitted: 2026-03-08 16:00:05, status changed: 2026-03-08 20:05:39

Project settings
Protein sequence(s) GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK input pdb
Peptide sequence IKLSPETKDNL
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.1813 7.02271 22.9435 226
cluster_2.pdb ( medoid) 28.2039 4.78657 18.3715 135
cluster_3.pdb ( medoid) 20.8689 3.64179 13.4423 76
cluster_4.pdb ( medoid) 11.6385 14.1771 31.3759 165
cluster_5.pdb ( medoid) 10.1424 11.8315 34.0841 120
cluster_6.pdb ( medoid) 9.18941 7.39982 19.653 68
cluster_7.pdb ( medoid) 5.49671 11.0976 28.7325 61
cluster_8.pdb ( medoid) 4.08587 12.2373 29.3718 50
cluster_9.pdb ( medoid) 3.58413 11.1603 26.9035 40
cluster_10.pdb ( medoid) 3.58185 16.4719 33.5781 59