CABS-dock: e4c233063d9c0d1

Project name: e4c233063d9c0d1

Status: done

submitted: 2026-03-08 16:00:05, status changed: 2026-03-08 20:05:39

Project settings

Protein sequence(s)	GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK input pdb
Peptide sequence	IKLSPETKDNL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.1813	7.02271	22.9435	226
cluster_2.pdb ( medoid)	28.2039	4.78657	18.3715	135
cluster_3.pdb ( medoid)	20.8689	3.64179	13.4423	76
cluster_4.pdb ( medoid)	11.6385	14.1771	31.3759	165
cluster_5.pdb ( medoid)	10.1424	11.8315	34.0841	120
cluster_6.pdb ( medoid)	9.18941	7.39982	19.653	68
cluster_7.pdb ( medoid)	5.49671	11.0976	28.7325	61
cluster_8.pdb ( medoid)	4.08587	12.2373	29.3718	50
cluster_9.pdb ( medoid)	3.58413	11.1603	26.9035	40
cluster_10.pdb ( medoid)	3.58185	16.4719	33.5781	59