CABS-dock: K1.1

Project name: K1.1_USP7

Status: done

submitted: 2026-01-12 05:25:37, status changed: 2026-01-12 09:25:15

Project settings

Protein sequence(s)	TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWGARAHSS input pdb
Peptide sequence	NEEEITTKGASAQSGTSGTSGTSGPSGP
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHCCCCCCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.0641	9.73218	26.085	205
cluster_2.pdb ( medoid)	14.7823	10.4178	28.0854	154
cluster_3.pdb ( medoid)	14.7812	5.95351	31.4688	88
cluster_4.pdb ( medoid)	14.5778	6.10516	23.9726	89
cluster_5.pdb ( medoid)	13.8101	7.60314	22.3064	105
cluster_6.pdb ( medoid)	9.03892	16.9268	34.8594	153
cluster_7.pdb ( medoid)	5.18849	4.04742	10.0533	21
cluster_8.pdb ( medoid)	4.85306	16.0723	38.2203	78
cluster_9.pdb ( medoid)	4.01546	18.1797	34.0087	73
cluster_10.pdb ( medoid)	2.94419	11.5482	29.4312	34