Project name: e56c892b8ed208f

Status: done

submitted: 2026-03-08 14:13:36, status changed: 2026-03-08 16:23:31

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence VQVFGDNNY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.3582 4.33666 16.7291 149
cluster_2.pdb ( medoid) 31.6352 5.59502 21.7503 177
cluster_3.pdb ( medoid) 30.4656 4.5297 21.0967 138
cluster_4.pdb ( medoid) 18.1479 5.56539 16.7016 101
cluster_5.pdb ( medoid) 9.53137 12.6949 31.4167 121
cluster_6.pdb ( medoid) 7.96698 8.78626 23.7382 70
cluster_7.pdb ( medoid) 7.46906 9.2381 30.138 69
cluster_8.pdb ( medoid) 5.66102 12.8952 25.1157 73
cluster_9.pdb ( medoid) 4.46595 10.9719 22.3971 49
cluster_10.pdb ( medoid) 3.52625 15.0301 31.393 53