CABS-dock: e58e1087c61f62f

Project name: e58e1087c61f62f

Status: done

submitted: 2025-04-22 12:19:19, status changed: 2025-04-22 18:17:38

Project settings

Protein sequence(s)	QPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK input pdb
Peptide sequence	MSYVSLSGLSAAQLD
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEECCCCCHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.8654	5.14219	17.476	169
cluster_2.pdb ( medoid)	21.6299	4.9931	20.8356	108
cluster_3.pdb ( medoid)	21.3308	7.17271	24.2832	153
cluster_4.pdb ( medoid)	20.2282	5.88287	21.4573	119
cluster_5.pdb ( medoid)	18.8258	5.52434	32.1653	104
cluster_6.pdb ( medoid)	18.1139	7.56327	22.6553	137
cluster_7.pdb ( medoid)	7.07894	9.18216	22.3782	65
cluster_8.pdb ( medoid)	5.7131	11.0273	25.7342	63
cluster_9.pdb ( medoid)	5.50342	9.08526	23.0206	50
cluster_10.pdb ( medoid)	2.62724	12.1801	23.7597	32