CABS-dock: e65544778e53776

Project name: e65544778e53776

Status: done

submitted: 2026-03-19 09:40:55, status changed: 2026-03-19 22:29:42

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	KRLVQVFGSNTYRLK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.7423	5.22275	22.9454	124
cluster_2.pdb ( medoid)	21.5786	5.32936	26.2467	115
cluster_3.pdb ( medoid)	18.8583	6.31023	46.079	119
cluster_4.pdb ( medoid)	13.7858	8.70462	29.0601	120
cluster_5.pdb ( medoid)	12.2177	11.868	33.1914	145
cluster_6.pdb ( medoid)	10.3454	12.3727	39.377	128
cluster_7.pdb ( medoid)	6.52822	11.9481	42.3951	78
cluster_8.pdb ( medoid)	5.27538	10.6153	36.385	56
cluster_9.pdb ( medoid)	3.80951	11.8126	24.57	45
cluster_10.pdb ( medoid)	3.05008	22.9503	49.2665	70