Project name: MAD20.3_USP7

Status: done

submitted: 2026-01-12 05:29:15, status changed: 2026-01-12 09:32:33

Project settings
Protein sequence(s) TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWGARAHSS input pdb
Peptide sequence ASVASGGSGGSVASGGSGNSRRTNPSDNSS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.1871 7.29658 29.8504 140
cluster_2.pdb ( medoid) 18.1988 6.0993 38.8227 111
cluster_3.pdb ( medoid) 14.4456 9.48387 27.3096 137
cluster_4.pdb ( medoid) 9.7494 14.1547 36.3053 138
cluster_5.pdb ( medoid) 9.68605 12.9052 39.1033 125
cluster_6.pdb ( medoid) 8.95441 14.853 44.69 133
cluster_7.pdb ( medoid) 8.75453 11.7653 44.3374 103
cluster_8.pdb ( medoid) 2.73644 21.5609 54.4225 59
cluster_9.pdb ( medoid) 1.99057 15.5734 31.1105 31
cluster_10.pdb ( medoid) 1.01757 22.6029 43.6669 23