CABS-dock: e6adcbaf40d8c65

Project name: e6adcbaf40d8c65

Status: done

submitted: 2026-01-22 13:05:26, status changed: 2026-01-22 20:09:32

Project settings

Protein sequence(s)	VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence	ATFDKNDEDSPIVMHQEDGST
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.8506	3.83521	16.6042	149
cluster_2.pdb ( medoid)	25.7698	5.19989	20.184	134
cluster_3.pdb ( medoid)	22.5679	3.89934	13.0903	88
cluster_4.pdb ( medoid)	16.1196	6.82397	41.2237	110
cluster_5.pdb ( medoid)	13.2151	6.81038	16.2051	90
cluster_6.pdb ( medoid)	12.7731	6.81116	45.2463	87
cluster_7.pdb ( medoid)	12.4178	10.2272	44.0292	127
cluster_8.pdb ( medoid)	8.07483	10.6504	21.4645	86
cluster_9.pdb ( medoid)	6.54456	11.3071	47.1722	74
cluster_10.pdb ( medoid)	3.50385	15.697	48.6709	55