Project name: e6d3e6d47e7573c

Status: done

submitted: 2026-06-02 11:07:18, status changed: 2026-06-02 17:52:56

Project settings
Protein sequence(s) DHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCIWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFN input pdb
Peptide sequence VPASYNPMVLIQKTDTGVSLQT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEEEEECCCCEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.8776 4.26087 9.17161 106
cluster_2.pdb ( medoid) 23.0511 9.11019 37.652 210
cluster_3.pdb ( medoid) 20.445 5.62485 35.0312 115
cluster_4.pdb ( medoid) 16.3112 7.1117 19.9368 116
cluster_5.pdb ( medoid) 9.97308 11.6313 35.2979 116
cluster_6.pdb ( medoid) 9.75842 8.30053 29.152 81
cluster_7.pdb ( medoid) 6.51316 13.5111 28.7451 88
cluster_8.pdb ( medoid) 5.61575 11.5746 40.7892 65
cluster_9.pdb ( medoid) 4.57408 9.61942 22.9224 44
cluster_10.pdb ( medoid) 3.53426 16.6937 37.8913 59